PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g011380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NAC
Protein Properties Length: 771aa    MW: 86792.5 Da    PI: 4.4945
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g011380.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM53.39.2e-17956149
             NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                    l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +d+yk+ePwdLp+
  Csa01g011380.1  9 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTDVYKSEPWDLPA 56
                    579**************************9.99**************94 PP

2NAM164.63.5e-51591861128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky +g+++nrat+ gyWk+tgkd+e+ 
  Csa01g011380.1  59 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTDVYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYGNGSKTNRATEMGYWKTTGKDREIR 152
                     579**************************9.99**************95347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + + ++vg+kktLv++kgrap+ge+++Wvmheyrl
  Csa01g011380.1 153 N-GPKVVGMKKTLVYHKGRAPRGERSNWVMHEYRL 186
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-17758IPR003441NAC domain
PROSITE profilePS5100512.125956IPR003441NAC domain
PfamPF023653.3E-71145IPR003441NAC domain
SuperFamilySSF1019413.4E-5958210IPR003441NAC domain
PROSITE profilePS5100557.4659210IPR003441NAC domain
PfamPF023654.2E-2761186IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MGGGSATSLA PGFRFHPTDE ELVRYYLKRK ICNKPFKFDA ISVTDVYKSE PWDLPATSLA  60
PGFRFHPTDE ELVRYYLKRK ICNKPFKFDA ISVTDVYKSE PWDLPDKSKL KSRDLEWYFF  120
SMLDKKYGNG SKTNRATEMG YWKTTGKDRE IRNGPKVVGM KKTLVYHKGR APRGERSNWV  180
MHEYRLVDDG LEKTGVHQQD AYVLCRIFQK SGSGPKNGEQ YGAPFVEEEW ETEDDIITFV  240
PDPDLGCEDY VYVHMDDIDQ VVWNLEALGI WKIQSVLEFN PHLGFDSKKP DNLVVYDAIP  300
LPLNFNHGES SNNAETNYSD SINYIQPGNY VDYGGYFEQP EESSEKDQKL IIRDGNLHID  360
ALFQDEEHGC GVQDEHTEKL QPSGNIFGTD SSGYNDFPAE SNYLTGGEFQ DPNSDVLQND  420
GLYLETNDLS SSQQYGFNVE DYLTFFDDDD ENAQYLTFDP SELMGDEDVF VDQEELFQEV  480
EKEETTGDKQ VVEAKEKDEA SCSKQVDADA TEFEPDYKYP FLKKATHMLG AIPAPPAFAS  540
EFPTKAAAFQ LNAGQSSGSV HVTAGMITIS ESNMGWSYDK NANRDLILSY RLVQENASGK  600
LGNSLTRAML IFMCFWVLIL SVSFKGSFSR PFXKDEASCS KQVDADATEF EPDYKYPFLK  660
KATHMLGAIP APPAFASEFP TKAAAFQLNA GQSSGSVHVT AGMITISESN MGWSYDKNAN  720
RDLILSYRLV QENASGKLGN SLTRAMLIFM CFWVLILSVS FKVSTLVTSQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-435421612171NAC domain-containing protein 19
4dul_A1e-435421612171NAC domain-containing protein 19
1ut7_B1e-435421612171NO APICAL MERISTEM PROTEIN
1ut7_A1e-435421612171NO APICAL MERISTEM PROTEIN
1ut4_B1e-435421612171NO APICAL MERISTEM PROTEIN
1ut4_A1e-435421612171NO APICAL MERISTEM PROTEIN
3swp_D1e-435421615174NAC domain-containing protein 19
3swp_C1e-435421615174NAC domain-containing protein 19
3swp_B1e-435421615174NAC domain-containing protein 19
3swp_A1e-435421615174NAC domain-containing protein 19
3swm_D1e-435421615174NAC domain-containing protein 19
3swm_C1e-435421615174NAC domain-containing protein 19
3swm_B1e-435421615174NAC domain-containing protein 19
3swm_A1e-435421615174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0510030.0AY051003.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
GenBankAY0793450.0AY079345.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010485093.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
RefseqXP_010485043.10.0PREDICTED: NAC domain-containing protein 78-like isoform X2
RefseqXP_010485001.10.0PREDICTED: NAC domain-containing protein 78-like isoform X1
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLR0HKM10.0R0HKM1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__1085__AT3G10500.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.10.0NAC domain containing protein 53